PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G01070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 402aa    MW: 43828.2 Da    PI: 9.6115
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G01070.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.45.8e-49311562128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                      +pGfrFhPt+eel+ +yL++kvegk++++ e i+ vd+y+++PwdLp+ ++ ++kew+f+++rd+ky++g+r+nr+t sgyWkatg d+ v+++
  OGLUM08G01070.1  31 MPGFRFHPTEEELIEFYLRRKVEGKRFNI-ELIAFVDLYRYDPWDLPALASIGDKEWFFYVPRDRKYRNGDRPNRVTPSGYWKATGADRMVKVE 123
                      79***************************.89***************888889***************************************** PP

              NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +glkktLvfy g+apkg +++W+m+eyrl
  OGLUM08G01070.1 124 GDRPIGLKKTLVFYVGKAPKGLRSSWIMNEYRL 156
                      *******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5630176IPR003441NAC domain
PROSITE profilePS5100555.0330176IPR003441NAC domain
PfamPF023651.8E-2432156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MRGSDHHQDV VAAPRGGAGG GDDGQAHDMV MPGFRFHPTE EELIEFYLRR KVEGKRFNIE  60
LIAFVDLYRY DPWDLPALAS IGDKEWFFYV PRDRKYRNGD RPNRVTPSGY WKATGADRMV  120
KVEGDRPIGL KKTLVFYVGK APKGLRSSWI MNEYRLPHGD ADRYQKEISL CRVYKRPGIE  180
DNFHLTGTTT KSSGSKAAAA MGKKHAAANR TSSTAAAAAP RLAPMFDGGG GHHSSALMGK  240
ATYNASHAAA EGTNAIAMSL SAAAALHPPA PAMFRSTASV ASLSSTTSTE EDGTSLFHLK  300
AGATTTNTTT MHHHHHHQQL PASTHALLNT NSSAMATIPI DELSRAIGSY SNNHHQPNST  360
TTHQSTALPP SQQSPLLPFA SMEKIWDWNP LLESPKVCTN FK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-543217619165NAC domain-containing protein 19
4dul_A1e-543217619165NAC domain-containing protein 19
1ut7_B1e-543217619165NO APICAL MERISTEM PROTEIN
1ut7_A1e-543217619165NO APICAL MERISTEM PROTEIN
1ut4_B1e-543217619165NO APICAL MERISTEM PROTEIN
1ut4_A1e-543217619165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0710520.0AK071052.1 Oryza sativa Japonica Group cDNA clone:J023075E09, full insert sequence.
GenBankAK0722750.0AK072275.1 Oryza sativa Japonica Group cDNA clone:J023012F04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006659059.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
TrEMBLA0A0E0AQ420.0A0A0E0AQ42_9ORYZ; Uncharacterized protein
STRINGBGIOSGA027877-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77063650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.28e-97NAC domain containing protein 35